KEGG   Addendum: AAF61454
Entry
AAF61454          CDS       T10000                                 
Symbol
AG9
Name
(KEGG) terpinolene synthase (EC:4.2.3.113)
  KO
K21930  terpinolene synthase [EC:4.2.3.113]
Taxonomy
TAX:46611
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers I; Pinales; Pinaceae; Abies
Organism
ag  Addendum (Abies grandis)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth Hormone_1
Other DBs
NCBI-ProteinID: AAF61454
GB: AF139206
UniProt: Q9M7D0
LinkDB
AA seq 630 aa
MALVSILPLSSKSVLHKSWIVSTYEHKAISRTIPNLGLRGRGKSVTHSLRMSLSTAVSDD
HGVQRRIVEFHSNLWDDDFIQSLSTPYGAPSYRERADRLIVEVKGIFTSISAEDGELITP
LNDLIQRLLMVDNVERLGIDRHFKNEIKAALDYVYSYWNEKGIGSGSDSGVADLNSTALG
FRILRLHGYSVSSDVLEHFKEEKEKGQFVCSAIQTEEEIKSVLNLFRASLIAFPGEKVME
EAEIFSKIYLKEALQNIAVSSLSREIEYVLEDGWQTNMPRLETRNYIDVLGENDRDETLY
MNMEKLLEIAKLEFNIFHSLQQRELKDLSRWWKDSGFSHLTFSRHRHVEFYALASCIETD
RKHSGFRLGFAKMCHLITVLDDIYDTFGTMEELELFTAAFKRWDPSATDLLPEYMKGLYM
VVYETVNEIAREADKSQGRETLNDARRAWEAYLDSYMKEAEWISSGYLPTFEEYMETSKV
SFGYRIFALQPILTMDVPLTHHILQEIDFPLRFNDLICSILRLKNDTRCYKADRARGEEA
SCISCYMKENPGSTEEDAINHINAMVNNLIKEVNWELLRQDGTAHIACKKHAFDILKGSL
HGYKYRDGFSVANKETKNWVRRTVLESVPL
Reference
  Authors
Bohlmann J, Phillips M, Ramachandiran V, Katoh S, Croteau R
  Title
cDNA cloning, characterization, and functional expression of four new monoterpene synthase members of the Tpsd gene family from grand fir (Abies grandis).
  Journal
Arch Biochem Biophys 368:232-43 (1999)
DOI:10.1006/abbi.1999.1332

DBGET integrated database retrieval system