KEGG   Addendum: AAF64242
Entry
AAF64242          CDS       T10000                                 

Definition
(KEGG) glutaryl-7-aminocephalosporanic-acid acylase (EC:3.5.1.93)
  KO
K12748  glutaryl-7-aminocephalosporanic-acid acylase [EC:3.5.1.93]
Taxonomy
TAX:293
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Brevundimonas
Organism
ag  Addendum (Brevundimonas diminuta)
SSDB
Motif
Pfam: Penicil_amidase HEAT_EZ Phage_Mu_Gam
Other DBs
NCBI-ProteinID: AAF64242
GB: AF251710
UniProt: Q9L5D6
LinkDB
Structure
PDB: 
1FM2 1KEH 1JW0 1JVZ

AA seq 720 aa
MLRVLHRAASALVMATVIGLAPGVAFALAEPTSTPQAPIAAYKPRSNEILWDGYGVPHIY
GVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQ
WYAQQSPDFRANLDAFAAGINAYAQQNPDDISPEVRQVLPVSGADVVAHAHRLMNFLYVA
SPGRTLGEGDPPDLADQGSNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEAHLVTPD
FEIYGATQIGLPVIRFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERRQA
SYRLRQADGSTVDKPLEIRSSVHGPVFERADGTAVAVRVAGLDRPGMLEQYFDMITAHSF
DDYEAAMARMQVPTFNIVYADREGTINYSFNGVAPKRAEGDIAFWQGNVPGDSSRYLWTE
THPLDDLPRVTNPPGGFVQNSNDPPWTPTWPVTYTPRDHPSYLAPQTPHSLRAQQSVRLM
SENDDLTLERFMALQFSHRAVMADRTLPDLIPAALIDPDPEVQAAARLLAAWDREFTSDS
RAALLFEEWARLFAGQNFAGQAAFATPWSLDKPVSTPYGVRDPKAAVDQLRTAIANTKRK
YGAIDRPFGDASRMILNDVNVPGAAGYGNLGSFRVFTWSDPDENGIRTPVHGETWVAMIE
FSTPVRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRREQVEAAVQERTPFNFKP
Comment
Unpublished sequence data: Kim DW, Kang SM, Yoon KH (2000).
Reference
  Authors
Kim Y, Yoon K, Khang Y, Turley S, Hol WG
  Title
The 2.0 A crystal structure of cephalosporin acylase.
  Journal
Structure 8:1059-68 (2000)
DOI:10.1016/S0969-2126(00)00505-0

DBGET integrated database retrieval system