Entry |
|
Symbol |
couN5
|
Name |
(KEGG) coumermycin A biosynthesis protein CouN5
|
KO |
K12720 | peptidyl carrier protein |
|
Taxonomy |
|
Lineage |
Bacteria; Bacillati; Actinomycetota; Actinomycetes; Kitasatosporales; Streptomycetaceae; Streptomyces |
Organism |
Streptomyces rishiriensis
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
AA seq |
89 aa
MATQTREDISSQLLTFIRESFLAGDPEGELDADTPLLELGILNSLNTAILVAHLGEDYGV
HVPLIDVTATTFKSVRTLSELVHESLSRK |
Reference |
|
Authors |
Wang ZX, Li SM, Heide L |
Title |
Identification of the coumermycin A(1) biosynthetic gene cluster of Streptomyces rishiriensis DSM 40489. |
Journal |
|
Reference |
|
Authors |
Schmutz E, Muhlenweg A, Li SM, Heide L |
Title |
Resistance genes of aminocoumarin producers: two type II topoisomerase genes confer resistance against coumermycin A1 and clorobiocin. |
Journal |
|