KEGG   Addendum: AAG38049
Entry
AAG38049          CDS       T10000                                 
Symbol
TBT
Name
(KEGG) 2-alpha-hydroxytaxane 2-O-benzoyltransferase (EC:2.3.1.166)
  KO
K12925  2alpha-hydroxytaxane 2-O-benzoyltransferase [EC:2.3.1.166]
Taxonomy
TAX:99806
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers II; Cupressales; Taxaceae; Taxus
Organism
Taxus cuspidata
SSDB
Motif
Pfam: Transferase SASA MAT1
Other DBs
NCBI-ProteinID: AAG38049
GB: AF297618
UniProt: Q9FPW3
LinkDB
AA seq 440 aa
MGRFNVDMIERVIVAPCLQSPKNILHLSPIDNKTRGLTNILSVYNASQRVSVSADPAKTI
REALSKVLVYYPPFAGRLRNTENGDLEVECTGEGAVFVEAMADNDLSVLQDFNEYDPSFQ
QLVFNLREDVNIEDLHLLTVQVTRFTCGGFVVGTRFHHSVSDGKGIGQLLKGMGEMARGE
FKPSLEPIWNREMVKPEDIMYLQFDHFDFIHPPLNLEKSIQASMVISFERINYIKRCMME
ECKEFFSAFEVVVALIWLARTKSFRIPPNEYVKIIFPIDMRNSFDSPLPKGYYGNAIGNA
CAMDNVKDLLNGSLLYALMLIKKSKFALNENFKSRILTKPSTLDANMKHENVVGCGDWRN
LGFYEADFGWGNAVNVSPMQQQREHELAMQNYFLFLRSAKNMIDGIKILMFMPASMVKPF
KIEMEVTINKYVAKICNSKL
Reference
  Authors
Walker K, Croteau R
  Title
Taxol biosynthesis: molecular cloning of a benzoyl-CoA:taxane 2alpha-O-benzoyltransferase cDNA from taxus and functional expression in Escherichia coli.
  Journal
Proc Natl Acad Sci U S A 97:13591-6 (2000)
DOI:10.1073/pnas.250491997

DBGET integrated database retrieval system