KEGG   Addendum: AAK38664
Entry
AAK38664          CDS       T10000                                 
Symbol
SDH
Name
(KEGG) secoisolariciresinol dehydrogenase (EC:1.1.1.331)
  KO
K19650  secoisolariciresinol dehydrogenase [EC:1.1.1.331]
Taxonomy
TAX:35933
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Berberidaceae; Podophylloideae; Podophyllum
Organism
ag  Addendum (Podophyllum peltatum)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD 3HCDH_N Epimerase Sacchrp_dh_NADP GDP_Man_Dehyd 2-Hacid_dh_C F420_oxidored Shikimate_DH
Other DBs
NCBI-ProteinID: AAK38664
GB: AF352734
UniProt: Q94KL8
Structure
LinkDB
AA seq 278 aa
MGSTSTPDSSTNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNI
GSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKR
VMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTS
LCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAV
AYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGLA
Comment
Incomplete sequence.
Reference
  Authors
Xia ZQ, Costa MA, Pelissier HC, Davin LB, Lewis NG
  Title
Secoisolariciresinol dehydrogenase purification, cloning, and functional expression. Implications for human health protection.
  Journal
J Biol Chem 276:12614-23 (2001)
DOI:10.1074/jbc.M008622200

DBGET integrated database retrieval system