KEGG   Addendum: AAL23619
Entry
AAL23619          CDS       T10000                                 

Symbol
CYP725A2
Name
(KEGG) taxane 13-alpha-hydroxylase (EC:1.14.14.106)
  KO
K12922  taxane 13alpha-hydroxylase [EC:1.14.14.106]
Taxonomy
TAX:99806
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers II; Cupressales; Taxaceae; Taxus
Organism
ag  Addendum (Taxus cuspidata)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAL23619
GB: AY056019
UniProt: Q8W4T9
LinkDB
AA seq 485 aa
MDALKQLEVSPSILFVTLAVMAGIILFFRSKRHSSVKLPPGNLGFPLVGETLQFVRSLGS
STPQQFIEERMSKFGDVFKTSIIGHPTVVLCGPAGNRLVLSNENKLVQMSWPSSMMKLIG
EDCLGGKTGEQHRIVRAALTRFLGPQALQNHFAKMSSGIQRHINEKWKGKDEATVLPLVK
DLVFSVASRLFFGITEEHLQEQLHNLLEVILVGSFSVPLNIPGFSYHKAIQARATLADIM
THLIEKRRNELRAGTASENQDLLSVLLTFTDERGNSLADKEILDNFSMLLHGSYDSTNSP
LTMLIKVLASHPESYEKVAQEQFGILSTKMEGEEIAWKDLKEMKYSWQVVQETLRMYPPI
FGTFRKAITDIHYNGYTIPKGWKLLWTTYSTQTKEEYFKDADQFKPSRFEEEGKHVTPYT
YLPFGGGMRVCPGWEFAKMETLLFLHHFVKAFSGLKAIDPNEKLSGKPLPPLPVNGLPIK
LYSRS
Reference
  Authors
Jennewein S1, Rithner CD, Williams RM, Croteau RB
  Title
Taxol biosynthesis: taxane 13 alpha-hydroxylase is a cytochrome P450-dependent monooxygenase.
  Journal
Proc Natl Acad Sci U S A 98:13595-600 (2001)
DOI:10.1073/pnas.251539398

DBGET integrated database retrieval system