KEGG   Addendum: AAM46061
Entry
AAM46061          CDS       T10000                                 
Symbol
VBPO
Name
(KEGG) vanadium-dependent bromoperoxidase (EC:1.11.1.18)
  KO
K20206  bromide peroxidase [EC:1.11.1.18]
Taxonomy
TAX:35170
  Lineage
Eukaryota; Rhodophyta; Florideophyceae; Corallinophycidae; Corallinales; Corallinaceae; Corallinoideae; Corallina
Organism
ag  Addendum (Corallina officinalis)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-ProteinID: AAM46061
GB: AF218810
UniProt: Q8LLW7
Structure
LinkDB
AA seq 598 aa
MGIPADNLQSRAKASFDTRVSAAELALARGVVPSLANGEELLYRNPDPENGDPSFIVSFT
KGLPHDDNGAIIDPDDFLAFVRAINSGDEKEIADLTLGPARDPDTGLPIWRSDLANSLEL
EVRGWENSSAGLTFDLEGPDAQSIAMPPAPVLTSPELIAEIAELYLMALGREIEFSEFDS
PKNAEYIQFAIDQLNGLEWFNTPAMLGDPPAEIRRRRGEVTVGNLFRGILPGSEVGPYLS
QYIIVGSKQIGSATGGNKTLVSPNAADEFDGEIAYGSITISQRVRIATPGRDFMTDLKVF
LDVQDAADFRGFESYEPGARLIRTIRDLATWVHFDALYEAYLNACLILLANRVPFDPNIP
FQQEDKLDNQDVFVNFGDAHVLSLVTEVATRALKAVRYQKFNIHRRLRPEATGGLISVNK
IAAEKGESVFPEVDLAVEELEDILEKAEISNRKQNIADGDPDPDPSFLLPQAFAEGSPFH
PSYGSGHAVVAGACVTILKAFFDSNFQIDQVFEVDKDEDKLVKSSFKGTLTVAGELNKLA
DNIAIGRNMAGVHYFSDQFESILLGEQVAIGILEEQSLTYGENFFFNLPKFDGTTIQI
Reference
  Authors
Carter JN, Beatty KE, Simpson MT, Butler A
  Title
Reactivity of recombinant and mutant vanadium bromoperoxidase from the red alga Corallina officinalis.
  Journal
J Inorg Biochem 91:59-69 (2002)
DOI:10.1016/S0162-0134(02)00400-2

DBGET integrated database retrieval system