KEGG   Addendum: AAM94799
Entry
AAM94799          CDS       T10000                                 
Symbol
calO2
Name
(KEGG) orsellenic acid P450 oxidase
  KO
K21257  orsellenic acid P450 oxidase [EC:1.14.-.-]
Taxonomy
TAX:1877
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora echinospora)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAM94799
GB: AF497482
UniProt: Q8KND6
Structure
LinkDB
AA seq 397 aa
MTAFDPTDADVRRDPYPSYHWLLRHDPVHRGAHRVWYVSRFADVRAVLGDERFARTGIRR
FWTDLVGPGLLAEIVGDIILFQDEPDHGRLRGVVGPAFSPSALRRLEPVIAGTVDDLLRP
ALARGAMDVVDELAYPLALRAVLGLLGLPAADWGAVGRWSRDVGRTLDRGASAEDMRRGH
AAIAEFADYVERALARRRREGGEDLLALMLDAHDRGLMSRNEIVSTVVTFIFTGHETVAS
QVGNAVLSLLAHPDQLDLLRRRPDLLAQAVEECLRYDPSVQSNTRQLDVDVELRGRRLRR
DDVVVVLAGAANRDPRRYDRPDDFDIERDPVPSMSFGAGMRYCLGSYLARTQLRAAVAAL
ARLPGLRLGCASDALAYQPRTMFRGLASLPIAFTPGG
Reference
  Authors
Ahlert J, Shepard E, Lomovskaya N, Zazopoulos E, Staffa A, Bachmann BO, Huang K, Fonstein L, Czisny A, Whitwam RE, Farnet CM, Thorson JS
  Title
The calicheamicin gene cluster and its iterative type I enediyne PKS.
  Journal
Science 297:1173-6 (2002)
DOI:10.1126/science.1072105

DBGET integrated database retrieval system