| | Addendum: AAN07909 | |
Entry |
|
Symbol |
albC
|
Name |
(KEGG) cyclo(L-leucyl-L-phenylalanyl) synthase (EC:2.3.2.20)
|
KO |
|
Taxonomy |
|
Lineage |
Bacteria; Actinomycetota; Actinomycetes; Kitasatosporales; Streptomycetaceae; Streptomyces |
Organism |
Streptomyces noursei
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
AA seq |
239 aa
MLAGLVPAPDHGMREEILGDRSRLIRQRGEHALIGISAGNSYFSQKNTVMLLQWAGQRFE
RTDVVYVDTHIDEMLIADGRSAQEAERSVKRTLKDLRRRLRRSLESVGDHAERFRVRSLS
ELQETPEYRAVRERTDRAFEEDAEFATACEDMVRAVVMNRPGDGVGISAEHLRAGLNYVL
AEAPLFADSPGVFSVPSSVLCYHIDTPITAFLSRRETGFRAAEGQAYVVVRPQELADAA |
Comment |
Unpublished sequence data: Lautru S, Gondry M, Genet R, Pernodet JL (2002).
|
Reference |
|
Authors |
Gondry M, Sauguet L, Belin P, Thai R, Amouroux R, Tellier C, Tuphile K, Jacquet M, Braud S, Courcon M, Masson C, Dubois S, Lautru S, Lecoq A, Hashimoto S, Genet R, Pernodet JL |
Title |
Cyclodipeptide synthases are a family of tRNA-dependent peptide bond-forming enzymes. |
Journal |
|
Reference |
|
Authors |
Sauguet L, Moutiez M, Li Y, Belin P, Seguin J, Le Du MH, Thai R, Masson C, Fonvielle M, Pernodet JL, Charbonnier JB, Gondry M |
Title |
Cyclodipeptide synthases, a family of class-I aminoacyl-tRNA synthetase-like enzymes involved in non-ribosomal peptide synthesis. |
Journal |
|
|
|