| Entry |
|
|---|
| Symbol |
andAb
|
|---|
| Name |
(KEGG) anthranilate 1,2-dioxygenase ferredoxin component
|
|---|
| KO |
| K18248 | anthranilate 1,2-dioxygenase ferredoxin component |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Pseudomonadati; Pseudomonadota; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderia cepacia complex |
|---|
| Organism |
Burkholderia cepacia
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
108 aa
MTEATLAEWHPLGAIDEFTEDEPAARVAGQKPIAVFRIGDELFAMHDLCSHGHARLSEGY
VEDGCVECPLHQGLIDIRTGAPKCAPITEPVRVYPIRIVDGQVEVNVG |
|---|
| Reference |
|
|---|
| Authors |
Chang HK, Mohseni P, Zylstra GJ |
|---|
| Title |
Characterization and regulation of the genes for a novel anthranilate 1,2-dioxygenase from Burkholderia cepacia DBO1. |
|---|
| Journal |
|
|---|
