| Entry |
|
|---|
| Symbol |
qdtA
|
|---|
| Name |
(KEGG) TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase
|
|---|
| KO |
| K24249 | TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase [EC:5.3.2.4] |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Bacillati; Bacillota; Clostridia; Thermoanaerobacterales; Thermoanaerobacteraceae; Thermoanaerobacterium |
|---|
| Organism |
Thermoanaerobacterium thermosaccharolyticum
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| Structure |
|
|---|
| LinkDB |
|
|---|
| AA seq |
136 aa
MLYNVALIKFKDIADKYGHLTPIEGKIDIPFDIKRVYYITKVDKDITRGYHAHKKLHQVL
ICLNGSVKIRLKIPDEEKIIELNDPSVGLYIGPFLWREMFDFTEGCVLLVLASEYCDETD
YIRNYDFYIDEAKKRF |
|---|
| Reference |
|
|---|
| Authors |
Altman E, Schaffer C, Brisson JR, Messner P |
|---|
| Title |
Characterization of the glycan structure of a major glycopeptide from the surface layer glycoprotein of Clostridium thermosaccharolyticum E207-71. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Pfostl A, Zayni S, Hofinger A, Kosma P, Schaffer C, Messner P |
|---|
| Title |
Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-glucose. |
|---|
| Journal |
|
|---|
