| Entry |
|
|---|
| Symbol |
fdtA
|
|---|
| Name |
(KEGG) TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-deoxy-alpha-D-galactopyranose-forming) (EC:5.3.2.3)
|
|---|
| KO |
| K20679 | TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase [EC:5.3.2.3] |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Bacillati; Bacillota; Bacilli; Bacillales; Paenibacillaceae; Aneurinibacillus group; Aneurinibacillus |
|---|
| Organism |
Aneurinibacillus thermoaerophilus
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| Structure |
|
|---|
| LinkDB |
|
|---|
| AA seq |
139 aa
MENKVINFKKIIDSRGSLVAIEENKNIPFSIKRVYYIFDTKGEEPRGFHAHKKLEQVLVC
LNGSCRVILDDGNIIQEITLDSPAVGLYVGPAVWHEMHDFSSDCVMMVLASDYYDETDYI
RQYDNFKKYIAKINLEKEG |
|---|
| Reference |
|
|---|
| Authors |
Novotny R, Pfoestl A, Messner P, Schaffer C |
|---|
| Title |
Genetic organization of chromosomal S-layer glycan biosynthesis loci of Bacillaceae. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Pfoestl A, Hofinger A, Kosma P, Messner P |
|---|
| Title |
Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-galactose in Aneurinibacillus thermoaerophilus L420-91T. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Davis ML, Thoden JB, Holden HM |
|---|
| Title |
The x-ray structure of dTDP-4-keto-6-deoxy-D-glucose-3,4-ketoisomerase. |
|---|
| Journal |
|
|---|
