KEGG   Addendum: AAT11920
Entry
AAT11920          CDS       T10000                                 
Symbol
CYP79D3
Name
(KEGG) isoleucine N-monooxygenase (EC:1.14.14.39)
  KO
K14984  isoleucine N-monooxygenase [EC:1.14.14.39]
Taxonomy
TAX:34305
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; robinioid clade; Loteae; Lotus
Organism
Lotus japonicus
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAT11920
GB: AY599895
UniProt: Q6J541
LinkDB
AA seq 535 aa
MGLMPDFLSLCHEFPWTFLLVVIFSFMIFKVTKTHLVNKSKKYKLPPGPKPWPIVGNLPE
MLANRPATIWIHKLMKEMNTEIACIRLANTIVIPVTCPTIACEFLKKHDASFASRPKIMS
TDIASDGFITTVLVPYGEQWKKMKRVLVNNLLSPQKHQWLLGKRNEEADNLMFYIYNKCC
KDVNDGPGLVNIRIAAQHYGGNVFRKLIFNSRYFGKVMEDGGPGFEEVEHINATFTILKY
VYAFSISDFVPFLRRLDLDGHRSKIMKAMRIMRKYHDPIIDDRIKQWNDGLKTVEEDLLD
VLIKLKDANNKPLLTLKELKAQIIELAIEMVDNPSNAFEWALAEMINQPELLKRATEELD
NVVGKERLVQESDIPKLQFVKACAREALRLHPMEYFNVPHLCMNDTMVGDYLFPKGTQVL
LSRVALGRNPKFWTDPLKFNPERHLKEGIDVVLTEPDLRFISFTTGRRSCPGVALGTTMT
VMLFARMLHGFSWSPPPDVSSIDLVPSKDDLFLAKPLLLVAKPRLAAELYRTNEI
Reference
  Authors
Forslund K, Morant M, Jorgensen B, Olsen CE, Asamizu E, Sato S, Tabata S, Bak S
  Title
Biosynthesis of the nitrile glucosides rhodiocyanoside A and D and the cyanogenic glucosides lotaustralin and linamarin in Lotus japonicus.
  Journal
Plant Physiol 135:71-84 (2004)
DOI:10.1104/pp.103.038059

DBGET integrated database retrieval system