KEGG   Addendum: AAU00089
Entry
AAU00089          CDS       T10000                                 
Symbol
dea
Name
(KEGG) phosphinothricin tripeptide acetyl hydrolase
  KO
K12915  phosphinothricin tripeptide acetyl hydrolase
Taxonomy
TAX:1938
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces viridochromogenes)
SSDB
Motif
Pfam: Abhydrolase_3 Say1_Mug180 BD-FAE Hydrolase_like
Other DBs
NCBI-ProteinID: AAU00089
GB: AY632421
UniProt: Q5IW46
LinkDB
AA seq 299 aa
MASSELELVRELIGLNWHTRNGDVEPRRVAYDRAQEAFGDLGLPPGETVVIGDCSAEWVR
PAQEDGRTLLYLHGGSYALGSPQSHRHLSSALGAAAGAAVLALHYRRPPESPFPAAVEDA
VAAYRMLRERGCPPGRITFAGDSAGAGLAVAALQVLRDAGDPLPAAAVCISPWADLACEG
ASHVTRKEREILLDTEDLLRMAGRYLAGTDPRNPLASPAHGDLTGLPPLLIQVGSEEVLY
DDARALEQAALKAGVPVTFDEWPEMFHVWHWYHPVLPEGRAAVETAGVFLRRATEEGER
Reference
  Authors
Blodgett JA, Zhang JK, Metcalf WW
  Title
Molecular cloning, sequence analysis, and heterologous expression of the phosphinothricin tripeptide biosynthetic gene cluster from Streptomyces viridochromogenes DSM 40736.
  Journal
Antimicrob Agents Chemother 49:230-40 (2005)
DOI:10.1128/AAC.49.1.230-240.2005

DBGET integrated database retrieval system