KEGG   Addendum: AAU20370
Entry
AAU20370          CDS       T10000                                 
Name
(KEGG) isopiperitenol dehydrogenase
  KO
K15090  isopiperitenol dehydrogenase [EC:1.1.1.223]
Taxonomy
TAX:34256
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Menthinae; Mentha
Organism
ag  Addendum (Mentha x piperita)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Epimerase Sacchrp_dh_NADP GDP_Man_Dehyd Shikimate_DH
Other DBs
NCBI-ProteinID: AAU20370
GB: AY641428
UniProt: Q5C9I9
LinkDB
AA seq 265 aa
MASVKKLAGKVAIVTGGASGIGEVTARLFAERGARAVVIADMQPEKGGTVAESIGGRRCS
YVHCDITDEQQVRSVVDWTAATYGGVDVMFCNAGTASATAQTVLDLDLAQFDRVMRVNAR
GTAACVKQAARKMVELGRGGAIICTASATVHHAGPNLTDYIMSKCGVLGLVRSASLQLGV
HGIRVNSVSPTALATPLTATIGLRTAADVESFYGQVTSLKGVAITAEHVAEAVAFLASDE
AAFVTGHDLAVDGGLQCLPFVAVAK
Reference
  Authors
Ringer KL, Davis EM, Croteau R
  Title
Monoterpene metabolism. Cloning, expression, and characterization of (-)-isopiperitenol/(-)-carveol dehydrogenase of peppermint and spearmint.
  Journal
Plant Physiol 137:863-72 (2005)
DOI:10.1104/pp.104.053298

DBGET integrated database retrieval system