KEGG   Addendum: AAZ78341
Entry
AAZ78341          CDS       T10000                                 
Symbol
oxyR
Name
(KEGG) 5a,11a-dehydrotetracycline reductase (EC:1.3.98.4)
  KO
K21301  5a,11a-dehydrotetracycline reductase [EC:1.3.98.4]
Taxonomy
TAX:1927
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces rimosus)
SSDB
Motif
Pfam: Putative_PNPOx Pyridox_ox_2
Other DBs
NCBI-ProteinID: AAZ78341
GB: DQ143963
UniProt: Q3S8P8
LinkDB
AA seq 142 aa
MPFTQKEITYLRAQGYGRLATVGAHGEPHNVPVSFEIDEERGTIEITGRDMGRSRKFRNV
AKSDRVAFVVDDVPCRDPEVVRAVVIHGTAQALPTGGRERRPHCADEMIRIHPRRIVTWG
IEGDLSTGVHARDITAEDGGRR
Reference
  Authors
Zhang W, Ames BD, Tsai SC, Tang Y
  Title
Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase.
  Journal
Appl Environ Microbiol 72:2573-80 (2006)
DOI:10.1128/AEM.72.4.2573-2580.2006
Reference
  Authors
Wang P, Bashiri G, Gao X, Sawaya MR, Tang Y
  Title
Uncovering the enzymes that catalyze the final steps in oxytetracycline biosynthesis.
  Journal
J Am Chem Soc 135:7138-41 (2013)
DOI:10.1021/ja403516u

DBGET integrated database retrieval system