KEGG   Addendum: AAZ78342
Entry
AAZ78342          CDS       T10000                                 
Symbol
oxyS
Name
(KEGG) anhydrotetracycline monooxygenase
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Taxonomy
TAX:1927
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces rimosus)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox HI0933_like FAD_binding_2 NAD_binding_8 Pyr_redox_2 Pyr_redox_3 Thi4
Other DBs
NCBI-ProteinID: AAZ78342
GB: DQ143963
UniProt: Q3S8P7
LinkDB
AA seq 503 aa
MRYDVVIAGAGPTGLMLACELRLAGARTLVLERLAEPVDFSKALGVHARTVELLDMRGLG
EGFQAEAPKLRGGNFASLGVPLDFSSFDTRHPYALFVPQVRTEELLTGRALELGAELRRG
HAVTALEQDADGVTVSVTGPEGPYEVECAYLVGCDGGGSTVRKLLGIDFPGQDPHMFAVI
ADARFREELPHGEGMGPMRPYGVMRHDLRAWFAAFPLEPDVYRATVAFFDRPYADRRAPV
TEEDVRAALTEVAGSDFGMHDVRWLSRLTDTSRQAERYRDGRVLLAGDACHIHLPAGGQG
LNLGFQDAVNLGWKLGATIAGTAPPELLDTYEAERRPIAAGVLRNTRAQAVLIDPDPRYE
GLRELMIELLHVPETNRYLAGLISALDVRYPMAGEHPLLGRRVPDLPLVTEDGTRQLSTY
FHAARGVLLTLGCDQPLADEAAAWKDRVDLVAAEGVADPGSAVDGLTALLVRPDGYICWT
AAPETGTDGLTDALRTWFGPPAM
Reference
  Authors
Zhang W, Ames BD, Tsai SC, Tang Y
  Title
Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase.
  Journal
Appl Environ Microbiol 72:2573-80 (2006)
DOI:10.1128/AEM.72.4.2573-2580.2006

DBGET integrated database retrieval system