KEGG   Addendum: ABX39510
Entry
ABX39510          CDS       T10000                                 
Symbol
wecP
Name
(KEGG) UDP-GalNAc:undecaprenyl-phosphate GalNAc-1-phosphate transferase (EC:2.7.8.40)
  KO
K21303  UDP-GalNAc:undecaprenyl-phosphate GalNAc-1-phosphate transferase [EC:2.7.8.40]
Taxonomy
TAX:644
  Lineage
Bacteria; Pseudomonadota; Gammaproteobacteria; Aeromonadales; Aeromonadaceae; Aeromonas
Organism
Aeromonas hydrophila
SSDB
Motif
Pfam: Bac_transf
Other DBs
NCBI-ProteinID: ABX39510
GB: EU274663
UniProt: B3FN88
LinkDB
AA seq 423 aa
MSYQRRHSRWYERVLFSPPSLFFLGAMLAVCLPALERWGWGFWEYFDAVRVNTLGGAFVA
FLLTGIVLYRFLRYPGASPVAYMIPTVTTLYGSLVGALFFLRLPYSRQVLFESYVVALLC
CWVVYFIGRRYRTPKYALLPFGDYQPLMHHTCVEWRLLDKPDLGAVRYDAVVADLRDDDL
AGEWERFLARCALAHIPVYHIKQISETLTGRVKIDHLHENQLGSLLPSPIYAFIKRGMDI
LAAVIAIPLFSPLMLATAVLIKLESPGPVMFLQNRVGKGNRDFRIYKFRSMCQNSEQHGA
QFAQDGDMRVTRVGKVIRKLRIDELPQFFNVLKGDMSLIGPRPEQRTFVDQFDREIPFYM
YRHIVRPGISGWAQVVHGYAADADDTRIKIEHDFYYIKNFSLWLDVLIVFKTIRTILTGF
GAR
Reference
  Authors
Jimenez N, Canals R, Salo MT, Vilches S, Merino S, Tomas JM
  Title
The Aeromonas hydrophila wb*O34 gene cluster: genetics and temperature regulation.
  Journal
J Bacteriol 190:4198-209 (2008)
DOI:10.1128/JB.00153-08
Reference
  Authors
Merino S, Jimenez N, Molero R, Bouamama L, Regue M, Tomas JM
  Title
A UDP-HexNAc:polyprenol-P GalNAc-1-P transferase (WecP) representing a new subgroup of the enzyme family.
  Journal
J Bacteriol 193:1943-52 (2011)
DOI:10.1128/JB.01441-10

DBGET integrated database retrieval system