KEGG   Addendum: ACF24767
Entry
ACF24767          CDS       T10000                                 
Name
(KEGG) (+)-alpha-terpineol synthase (EC:4.2.3.112)
  KO
K21926  (+)-alpha-terpineol/(4S)-limonene synthase [EC:4.2.3.112 4.2.3.16]
Taxonomy
TAX:35974
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; Santalales; Santalaceae; Santalum
Organism
ag  Addendum (Santalum album)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 RapH_N DUF6793
Other DBs
NCBI-ProteinID: ACF24767
GB: EU798692
UniProt: B5A434
LinkDB
AA seq 576 aa
MDAFATSPTSALIKAVNCIAHVTPMAGEDSSENRRASNYKPSTWDYEFLQSLATSHNTVQ
EKHMKMAEKLKEEVKSMIKGQMEPVAKLELINILQRLGLKYRFESEIKEELFSLYKDGTD
AWWVDNLHATALRFRLLRENGIFVPQDVFETLKDKSGKFKSQLCKDVRGLLSLYEASYLG
WEGEDLLDEAKKFSTTNLNNVKESISSNTLGRLVKHALNLPLHWSAARYEARWFIDEYEK
EENVNPNLLKYAKLDFNIVQSIHQQELGNLARWWVETGLDKLSFVRNTLMQNFMWGCAMV
FEPQYGKVRDAAVKQASLIAMVDDVYDVYGSLEELEIFTDIVDRWDITGIDKLPRNISMI
LLTMFNTANQIGYDLLRDRGFNGIPHIAQAWATLCKKYLKEAKWYHSGYKPTLEEYLENG
LVSISFVLSLVTAYLQTEILENLTYESAAYVNSVPPLVRYSGLLNRLYNDLGTSSAEIAR
GDTLKSIQCYMTQTGATEEAAREHIKGLVHEAWKGMNKCLFEQTPFAEPFVGFNVNTVRG
SQFFYQHGDGYAVTESWTKDLSLSVLIHPIPLNEED
Reference
  Authors
Jones CG, Keeling CI, Ghisalberti EL, Barbour EL, Plummer JA, Bohlmann J
  Title
Isolation of cDNAs and functional characterisation of two multi-product terpene synthase enzymes from sandalwood, Santalum album L.
  Journal
Arch Biochem Biophys 477:121-30 (2008)
DOI:10.1016/j.abb.2008.05.008

DBGET integrated database retrieval system