KEGG   Addendum: ACP17973
Entry
ACP17973          CDS       T10000                                 
Symbol
iem
Name
(KEGG) isoeugenol monooxygenase (EC:1.13.11.88)
  KO
K23363  isoeugenol monooxygenase [EC:1.13.11.88]
Taxonomy
TAX:46680
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas nitroreducens)
SSDB
Motif
Pfam: RPE65
Other DBs
NCBI-ProteinID: ACP17973
GB: FJ851547
UniProt: C3VA26
LinkDB
AA seq 478 aa
MARLNRNDPQLVGTLLPTRIEADLFDLEVDGEIPKSINGTFYRNTPEPQVTPQKFHTFID
GDGMASAFHFEDGHVDFISRWVKTARFTAERLARKSLFGMYRNPYTDDTSVKGLDRTVAN
TSIISHHGKVLAVKEDGLPYELDPRTLETRGRFDYDGQVTSQTHTAHPKYDPETGDLLFF
GSAAKGEATPDMAYYIVDKHGKVTHETWFEQPYGAFMHDFAITRNWSIFPIMPATNSLSR
LKAKQPIYMWEPELGSYIGVLPRRGQGSQIRWLKAPALWVFHVVNAWEVGTKIYIDLMES
EILPFPFPNSQNQPFAPEKAVPRLTRWEIDLDSSSDEIKRTRLHDFFAEMPIMDFRFALQ
CNRYGFMGVDDPRKPLAHQQAEKIFAYNSLGIWDNHRGDYDLWYSGEASAAQEPAFVPRS
PTAAEGDGYLLTVVGRLDENRSDLVILDTQDIQSGPVATIKLPFRLRAALHGCWVPRP
Reference
  Authors
Ryu JY, Seo J, Unno T, Ahn JH, Yan T, Sadowsky MJ, Hur HG
  Title
Isoeugenol monooxygenase and its putative regulatory gene are located in the eugenol metabolic gene cluster in Pseudomonas nitroreducens Jin1.
  Journal
Arch Microbiol 192:201-9 (2010)
DOI:10.1007/s00203-010-0547-y

DBGET integrated database retrieval system