KEGG   Addendum: ACY41153
Entry
ACY41153          CDS       T10000                                 
Symbol
XPT1
Name
(KEGG) 3-O-alpha-D-mannopyranosyl-alpha-D-mannopyranose xylosylphosphotransferase (EC:2.7.8.32)
  KO
K18706  3-O-alpha-D-mannopyranosyl-alpha-D-mannopyranose xylosylphosphotransferase [EC:2.7.8.32]
Taxonomy
TAX:5207
  Lineage
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus; Cryptococcus neoformans species complex
Organism
ag  Addendum (Cryptococcus neoformans)
SSDB
Motif
Pfam: Stealth_CR3 Stealth_CR4 Stealth_CR2 Stealth_CR1
Other DBs
NCBI-ProteinID: ACY41153
GB: GQ403790
UniProt: D0U690
LinkDB
AA seq 864 aa
MPSTALSPPSRPPAQSYDSYSSSLSPSSPRFHAAAGSHGRRSPSPSRLESLLDGPHVPPR
SPSRKIRSALSRHIRPHITPRTLTPVFLWTLALWLIHHFLFPLSSPFAKLAKPKAEEHFL
STTFPPPAQRLGDDRLDSVDPRWRAYHPLPAPEPPFPRLRPTRFLPPQCLEQWFAEGETL
CGAKEMGEEETLDATWLWVNGSDHRWRDSMVEWREKENVNSPERHYREQNELVHSMRSVL
DALPGHLRTFHLILADYPFNYPEDLELVPSSIIPDLEVAASKSKGRRHPRELPGAPASLA
NLTERVTPESISPTLASHLQSEWRILQTPTWLDFSRRDPSDPSHPFHPYSVSKAGEIRQH
YAEASYPTLRYASHWEVFHIPSVDRDGRQELMGEREWRENEWKKKALPSFNSMAIESRIG
WLPGLADAIIALNDDFFLLRPHAVSDFHSPLYGSVIRFEHGYNQQVKPDVEKNHINDPGE
MGGLYHANALLSRRFPRRLRPYFAHVPKVITRGLHHEASLMFQEALTESSTRRFREMKIG
EGDVQMQWLLTSLRVERWREALLWTWTVANMGTLGGSQDHWDNDTRRAIKNLFGFTENDD
DVVKIEVHRGERWTLEPGRMQRVFRQAGWEAPKATEFLFSSMDGIMPPLLRSGEDPAQND
RCIIDLNRCFGLFWTREEDVLSSDMMKRLTFQYPECGDCMIMALVTASGTLGLNAFFPPK
ETTITAPELGPGDAYPKFLPPPHLPLTPTWHEADFSLANILSTTALPGEQVDIRQYCMRL
LSRYLYLDAKSVSHFHMMKSAEHARRVFRMIQGDPKVSILGMNDDIESDYDEVRGLMNEW
FEMRWPRKAVWERDWDPVKDRYND
Reference
  Authors
Reilly MC, Levery SB, Castle SA, Klutts JS, Doering TL
  Title
A novel xylosylphosphotransferase activity discovered in Cryptococcus neoformans.
  Journal
J Biol Chem 284:36118-27 (2009)
DOI:10.1074/jbc.M109.056226

DBGET integrated database retrieval system