KEGG   Addendum: AEI98656
Entry
AEI98656          CDS       T10000                                 
Symbol
ctcM
Name
(KEGG) 5a,11a-dehydrotetracycline reductase
  KO
K21301  5a,11a-dehydrotetracycline reductase [EC:1.3.98.4]
Taxonomy
TAX:1894
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora
Organism
ag  Addendum (Kitasatospora aureofaciens)
SSDB
Motif
Pfam: Putative_PNPOx Pyridox_ox_2
Other DBs
NCBI-ProteinID: AEI98656
GB: HM627755
UniProt: S4S395
LinkDB
AA seq 140 aa
MPFTAKEAAYLASQPLARLATVDGRGQPHVVPLGFHYNAELGTVDVTGRGMARSLKYRHV
QGHPRVSLVVDDIVDAQRWVVRGIEIRGTAVALATGGKEILPHVDDELIRITPERIVSWG
IDSDCQAPPLARNVGAGAQA
Reference
  Authors
Zhu T, Cheng X, Liu Y, Deng Z, You D
  Title
Deciphering and engineering of the final step halogenase for improved chlortetracycline biosynthesis in industrial Streptomyces aureofaciens.
  Journal
Metab Eng 19:69-78 (2013)
DOI:10.1016/j.ymben.2013.06.003

DBGET integrated database retrieval system