KEGG   Addendum: AFK77668
Entry
AFK77668          CDS       T10000                                 

Symbol
hcmA
Name
(KEGG) 2-hydroxyisobutanoyl-CoA mutase large subunit (EC:5.4.99.64)
  KO
K20906  2-hydroxyisobutanoyl-CoA mutase large subunit [EC:5.4.99.64]
Taxonomy
TAX:391953
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Aquincola
Organism
ag  Addendum (Aquincola tertiaricarbonis)
SSDB
Motif
Pfam: MM_CoA_mutase REV
Other DBs
NCBI-ProteinID: AFK77668
GB: JQ708092
UniProt: I3VE77
LinkDB
Structure
PDB: 
4R3U

AA seq 562 aa
MTWLEPQIKSQLQSERKDWEANEVGAFLKKAPERKEQFHTIGDFPVQRTYTAADIADTPL
EDIGLPGRYPFTRGPYPTMYRSRTWTMRQIAGFGTGEDTNKRFKYLIAQGQTGISTDFDM
PTLMGYDSDHPMSDGEVGREGVAIDTLADMEALLADIDLEKISVSFTINPSAWILLAMYV
ALGEKRGYDLNKLSGTVQADILKEYMAQKEYIYPIAPSVRIVRDIITYSAKNLKRYNPIN
ISGYHISEAGSSPLQEAAFTLANLITYVNEVTKTGMHVDEFAPRLAFFFVSQGDFFEEVA
KFRALRRCYAKIMKERFGARNPESMRLRFHCQTAAATLTKPQYMVNVVRTSLQALSAVLG
GAQSLHTNGYDEAFAIPTEDAMKMALRTQQIIAEESGVADVIDPLGGSYYVEALTTEYEK
KIFEILEEVEKRGGTIKLIEQGWFQKQIADFAYETALRKQSGQKPVIGVNRFVENEEDVK
IEIHPYDNTTAERQISRTRRVRAERDEAKVQAMLDQLVAVAKDESQNLMPLTIELVKAGA
TMGDIVEKLKGIWGTYRETPVF
Reference
  Authors
Yaneva N, Schuster J, Schafer F, Lede V, Przybylski D, Paproth T, Harms H, Muller RH, Rohwerder T
  Title
Bacterial acyl-CoA mutase specifically catalyzes coenzyme B12-dependent isomerization of 2-hydroxyisobutyryl-CoA and (S)-3-hydroxybutyryl-CoA.
  Journal
J Biol Chem 287:15502-11 (2012)
DOI:10.1074/jbc.M111.314690

DBGET integrated database retrieval system