KEGG   Addendum: BAA02127
Entry
BAA02127          CDS       T10000                                 
Name
(KEGG) aliphatic nitrilase (EC:3.5.5.7)
  KO
K01502  aliphatic nitrilase [EC:3.5.5.7]
Taxonomy
TAX:1829
  Lineage
Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus
Organism
ag  Addendum (Rhodococcus rhodochrous)
SSDB
Motif
Pfam: CN_hydrolase CrtC
Other DBs
NCBI-ProteinID: BAA02127
GB: D12583
UniProt: Q02068
LinkDB
AA seq 383 aa
MSSNPELKYTGKVKVATVQAEPVILDADATIDKAIGFIEEAAKNGAEFLAFPEVWIPGYP
YWAWIGDVKWAVSDFIPKYHENSLTLGDDRMRRLQLAARQNNIALVMGYSEKDGASRYLS
QVFIDQNGDIVANRRKLKPTHVERTIYGEGNGTDFLTHDFGFGRVGGLNCWEHFQPLSKY
MMYSLNEQIHVASWPAMFALTPDVHQLSVEANDTVTRSYAIEGQTFVLASTHVIGKATQD
LFAGDDDAKRALLPLGQGWARIYGPDGKSLAEPLPEDAEGLLYAELDLEQIILAKAAADP
AGHYSRPDVLSLKIDTRNHTPVQYITADGRTSLNSNSRVENYRLHQLADIEKYENAEAAT
LPLDAPAPAPAPEQKSGRAKAEA
Reference
PMID:1390687
  Authors
Kobayashi M, Yanaka N, Nagasawa T, Yamada H
  Title
Primary structure of an aliphatic nitrile-degrading enzyme, aliphatic nitrilase, from Rhodococcus rhodochrous K22 and expression of its gene and identification of its active site residue.
  Journal
Biochemistry 31:9000-7 (1992)
DOI:10.1021/bi00152a042

DBGET integrated database retrieval system