KEGG   Addendum: BAA03670
Entry
BAA03670          CDS       T10000                                 

Symbol
mycF
Name
(KEGG) mycinamicin III 3''-O-methyltransferase (EC:2.1.1.237)
  KO
K21539  mycinamicin III 3''-O-methyltransferase [EC:2.1.1.237]
Taxonomy
TAX:28040
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora griseorubida)
Module
28040_M00934  Mycinamicin biosynthesis, malonyl-CoA + methylmalonyl-CoA => protomycinolide IV => mycinamicin II
SSDB
Motif
Pfam: TylF Methyltransf_24 CmcI
Other DBs
NCBI-ProteinID: BAA03670
GB: D16097
UniProt: Q49492
Structure
LinkDB
AA seq 254 aa
MSPSTGVELYLDLLKRTVSNFIYQDATHVAGLITEAAFVEEARESGEDYPTVAHTMIGMK
RLNNLQHCVESALRDGVPGDVLETGVWRGGACIFARGILKAYDVRDRTVWVADSFQGFPK
ITDDDHPMDAEMNLHQYNEAVDLPTSLATVQRNFSRYGLLDDQVRFLPGWFKDTMPTAPF
ERLAVLRMDGDSYGATMDVLTHAYPRLSPGGFAIIDDYCIPACREAVHEYRDRHGISDEI
VEIDRQGVYWRRSA
Reference
PMID:8163162
  Authors
Inouye M, Suzuki H, Takada Y, Muto N, Horinouchi S, Beppu T
  Title
A gene encoding mycinamicin III O-methyltransferase from Micromonospora griseorubida.
  Journal
Gene 141:121-4 (1994)
DOI:10.1016/0378-1119(94)90138-4
Reference
  Authors
Li S, Anzai Y, Kinoshita K, Kato F, Sherman DH
  Title
Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics.
  Journal
Chembiochem 10:1297-301 (2009)
DOI:10.1002/cbic.200900088

DBGET integrated database retrieval system