KEGG   Addendum: BAA03672
Entry
BAA03672          CDS       T10000                                 
Symbol
mycG
Name
(KEGG) mycinamicin IV hydroxylase/epoxidase
  KO
K24390  mycinamicin IV hydroxylase/epoxidase [EC:1.14.-.-]
Taxonomy
TAX:28040
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora griseorubida)
Module
28040_M00934  Mycinamicin biosynthesis, malonyl-CoA + methylmalonyl-CoA => protomycinolide IV => mycinamicin II
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAA03672
GB: D16098
UniProt: Q59523
Structure
LinkDB
AA seq 397 aa
MTSAEPRAYPFNDVHGLTLAGRYGELQETEPVSRVRPPYGEEAWLVTRYEDVRAVLGDGR
FVRGPSMTRDEPRTRPEMVKGGLLSMDPPEHSRLRRLVVKAFTARRAESLRPRAREIAHE
LVDQMAATGQPADLVAMFARQLPVRVICELLGVPSADHDRFTRWSGAFLSTAEVTAEEMQ
EAAEQAYAYMGDLIDRRRKEPTDDLVSALVQARDQQDSLSEQELLDLAIGLLVAGYESTT
TQIADFVYLLMTRPELRRQLLDRPELIPSAVEELTRWVPLGVGTAFPRYAVEDVTLRGVT
IRAGEPVLASTGAANRDQAQFPDADRIDVDRTPNQHLGFGHGVHHCLGAPLARVELQVAL
EVLLQRLPGIRLGIPETQLRWSEGMLLRGPLELPVVW
Reference
PMID:7808395
  Authors
Inouye M, Takada Y, Muto N, Beppu T, Horinouchi S
  Title
Characterization and expression of a P-450-like mycinamicin biosynthesis gene using a novel Micromonospora-Escherichia coli shuttle cosmid vector.
  Journal
Mol Gen Genet 245:456-64 (1994)
DOI:10.1007/BF00302258

DBGET integrated database retrieval system