KEGG   Addendum: BAA07387
Entry
BAA07387          CDS       T10000                                 
Symbol
cts8
Name
(KEGG) anhydrotetracycline monooxygenase
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Taxonomy
TAX:1894
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora
Organism
ag  Addendum (Kitasatospora aureofaciens)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox Pyr_redox_2 HI0933_like Pyr_redox_3 NAD_binding_8 DUF1059 ApbA
Other DBs
NCBI-ProteinID: BAA07387
GB: D38214
UniProt: Q53657
LinkDB
AA seq 469 aa
MVVAGAGPTGLMLACELALGGARAVVVERRREPEKHSKAMGMQGRTVELLELRGLLDRFK
EGAGVLQGGNFASLGVPMRFEEFDTQPTQYVLLVPQLRTEELLAERARELGVRIVRGSGV
TGFAQDADGVTVETDTGLLRARYLVGCDGGSTVRKAAGIGFTGQDPHMYALIGDMRFSGD
LPRGEGLGPMRPVGLVYRATVAWFDRPFADRRAPVTEEEMRAALVEHTGSDHGMHDVTWL
SRLTDVSRLADSYRLGRVLLAGDAAHIHLPAGGQGLNLGFQDAVNLGWKLAAVVRGHGTE
ELLDSYGRERRPIADGVVRNTRTQAVLIDPDPRYEALRQTLPHLMALPDTNRHMAGMLSG
FDVAYGGGDHPLVGRRMPDAELITADGPRRISDCFAGARGLLLLPEQGPTASPLAAWADR
VDTLTVKSGGPDPDTAHLVRPDGYVAWAGEPARTEELHHAATTWFGAAA
Reference
PMID:7612997
  Authors
Dairi T, Nakano T, Aisaka K, Katsumata R, Hasegawa M.
  Title
Cloning and nucleotide sequence of the gene responsible for chlorination of tetracycline.
  Journal
Biosci Biotechnol Biochem 59:1099-106 (1995)
DOI:10.1271/bbb.59.1099

DBGET integrated database retrieval system