| Entry |
|
|---|
| Symbol |
dsoA
|
|---|
| Name |
(KEGG) assimilatory dimethylsulfide S-monooxygenase DsoA
|
|---|
| KO |
| K16249 | phenol/toluene 2-monooxygenase (NADH) P0/A0 |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Moraxellales; Moraxellaceae; Acinetobacter |
|---|
| Organism |
Acinetobacter sp.
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
96 aa
MIDAKQPTALVKYIRITGERNAKFVEFDFAIQDPTLFVELILPQQAFQHFCEINHVIEMT
AEQQAWNDAQEDKWRYGIEPTVLNHARQHSDQDDQA |
|---|
| Reference |
|
|---|
| Authors |
Horinouchi M, Kasuga K, Nojiri H, Yamane H, Omori T |
|---|
| Title |
Cloning and characterization of genes encoding an enzyme which oxidizes dimethyl sulfide in Acinetobacter sp. strain 20B. |
|---|
| Journal |
|
|---|
