| Entry |
|
| Symbol |
dsoE
|
| Name |
(KEGG) assimilatory dimethylsulfide S-monooxygenase DsoE (EC:1.14.13.245)
|
| KO |
|
| Taxonomy |
|
| Lineage |
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Moraxellales; Moraxellaceae; Acinetobacter |
| Organism |
Acinetobacter sp.
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| AA seq |
120 aa
MTVQAIVEKYQFEPLDLQQNYGENMLLFIGWDHHTLFCSAHAFVVSPKQSLQALIDGQIQ
AGFEQHPDFKHIDWSKVEFRLNRKLLQADFSKSLEDLGFDHKSLLRFVTPDLTGYQGTHV |
| Reference |
|
| Authors |
Horinouchi M, Kasuga K, Nojiri H, Yamane H, Omori T |
| Title |
Cloning and characterization of genes encoding an enzyme which oxidizes dimethyl sulfide in Acinetobacter sp. strain 20B. |
| Journal |
|