KEGG   Addendum: BAA84216
Entry
BAA84216          CDS       T10000                                 
Symbol
ugl
Name
(KEGG) gellan tetrasaccharide unsaturated glucuronyl hydrolase (EC:3.2.1.179)
  KO
K20831  gellan tetrasaccharide unsaturated glucuronyl hydrolase [EC:3.2.1.179]
Taxonomy
TAX:84635
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus
Organism
ag  Addendum (Bacillus sp. GL1)
SSDB
Motif
Pfam: Glyco_hydro_88 V_ATPase_prox
Other DBs
NCBI-ProteinID: BAA84216
GB: AB019619
UniProt: Q9RC92
Structure
LinkDB
AA seq 377 aa
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGD
EQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVL
MRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKS
RRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNA
DLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESD
PERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEA
LLRLERGVTGYWYERGR
Reference
  Authors
Hashimoto W, Kobayashi E, Nankai H, Sato N, Miya T, Kawai S, Murata K
  Title
Unsaturated glucuronyl hydrolase of Bacillus sp. GL1: novel enzyme prerequisite for metabolism of unsaturated oligosaccharides produced by polysaccharide lyases.
  Journal
Arch Biochem Biophys 368:367-74 (1999)
DOI:10.1006/abbi.1999.1305
Reference
  Authors
Itoh T, Hashimoto W, Mikami B, Murata K
  Title
Substrate recognition by unsaturated glucuronyl hydrolase from Bacillus sp. GL1.
  Journal
Biochem Biophys Res Commun 344:253-62 (2006)
DOI:10.1016/j.bbrc.2006.03.141

DBGET integrated database retrieval system