KEGG   Addendum: BAB68769
Entry
BAB68769          CDS       T10000                                 
Symbol
CYP719A1
Name
(KEGG) (S)-canadine synthase (EC:1.14.19.68)
  KO
K13395  (S)-stylopine/(S)-canadine/(S)-nandinine synthase [EC:1.14.19.64 1.14.19.68 1.14.19.73]
Taxonomy
TAX:3442
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Ranunculaceae; Coptidoideae; Coptis
Organism
ag  Addendum (Coptis japonica)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAB68769
GB: AB026122
UniProt: Q948Y1
LinkDB
AA seq 491 aa
MEMNPLLVCATVAIVFATTTIIRILFSSSSLPQMKWPSGPRKLPIIGNLHQLGDDVLHVA
LAKLAKVHGSVMTIWIGSWRPVIVISDIEKAWEVLVNKSADYGARDMPEITKIASASWHT
ISTSDAGSFWQNVRKGLQSGAMGPLNVAAQNQYQERDMKRLIKAMSDEAANNNGIVKPLD
HIKKNTVRLLTRLIFGQAFDDNKFIESMHYEIEDIIRISGYARLAEAFYYAKYLPSHKKA
EREAFLVKCRVEELVRPLLSSKPPTNSYLYFLLSQNFEEEVIIFCIFELYLLGVDSTSST
TTWALAYLIREQGAQEKLYQDIRMTLGDVDLVKIEDVNKLKYLQGVVKETMRMKPIAPLA
IPHKTAKETTLMGTKVAKGTRIMVNLYALHHNQNIWPDPYKFMPERFLEGETGTAYNKAM
EQSFLPFSAGMRICAGMDLGKLQFAFALANLVNAFKWSCVEEGKLPDMGEELSFVLLMKT
PLEARIAGRNV
Reference
  Authors
Ikezawa N, Tanaka M, Nagayoshi M, Shinkyo R, Sakaki T, Inouye K, Sato F
  Title
Molecular cloning and characterization of CYP719, a methylenedioxy bridge-forming enzyme that belongs to a novel P450 family, from cultured Coptis japonica cells.
  Journal
J Biol Chem 278:38557-65 (2003)
DOI:10.1074/jbc.M302470200

DBGET integrated database retrieval system