KEGG   Addendum: BAC23089
Entry
BAC23089          CDS       T10000                                 

Gene name
bphC
Definition
(KEGG) biphenyl-2,3-diol 1,2-dioxygenase (EC:1.13.11.39)
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Taxonomy
  Lineage
Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus
Organism
ag  Addendum (Geobacillus genomosp. 3)
SSDB
Motif
Pfam: Glyoxalase RraB
Other DBs
NCBI-ProteinID: BAC23089
GB: AB092521
UniProt: Q8GR45
LinkDB
AA seq 315 aa
MTAEIAKFGHIALITPNLEKSVWFFRDIVGLEEVDRQGDTIFLRAWGDWEHHTLSLTPGN
RARVDHIAWRTKRPEDVETFAEQLKAKGTEVQWIEPGEEKGQGKAIRFRLPNGYPFEIYY
DVEKPKAPEGKKSRLKNNVYRPSYGIAPRRIDHVNVWTTNPSEIHQWLKDNMGFKMREYI
RLNNGFVAGGWMSVTPLVHDIGVMVDPKGQPNRLHHFAYYLDNVTDILRAADILREHDIT
IEMGGPGRHGISQAFFLYVKDPGSGHRLELFSGGYLIFDPDWEPIEWQEHELQEGLIWYG
PEMKPGGPMDDTTEC
Reference
  Authors
Hatta T, Mukerjee-Dhar G, Damborsky J, Kiyohara H, Kimbara K
  Title
Characterization of a novel thermostable Mn(II)-dependent 2,3-dihydroxybiphenyl 1,2-dioxygenase from a polychlorinated biphenyl- and naphthalene-degrading Bacillus sp. JF8.
  Journal
J Biol Chem 278:21483-92 (2003)
DOI:10.1074/jbc.M210240200

DBGET integrated database retrieval system