KEGG   Addendum: BAC57026
Entry
BAC57026          CDS       T10000                                 
Symbol
mycE
Name
(KEGG) mycinamicin VI 2''-O-methyltransferase (EC:2.1.1.238)
  KO
K21540  mycinamicin VI 2''-O-methyltransferase [EC:2.1.1.238]
Taxonomy
TAX:28040
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora griseorubida)
Module
28040_M00934  Mycinamicin biosynthesis, malonyl-CoA + methylmalonyl-CoA => protomycinolide IV => mycinamicin II
SSDB
Motif
Pfam: MycE_N Methyltransf_24 CmcI
Other DBs
NCBI-ProteinID: BAC57026
GB: AB089954
UniProt: Q83WF2
Structure
LinkDB
AA seq 399 aa
MTAQTEFDEATVQDVVRLAGGHDSELRELTQKYDPAMISRLLVAEILSRCPPPSNDTPVL
VELAIVHGSERFRHFLRVVRDSPIRPVGADEGFVGMLVEYELTELLRELFGVTHERPAGV
RGTKLFPYLTDDEEAVEQIGTYLLAAQQGTEAVLAGCGSRKPDLSELSSRYFTPKFGFLH
WFTPHYDRHFRDYRNQQVRVLEIGVGGYKHPEWGGGSLRMWKSFFPRGQIYGLDIMDKSH
VDELRIRTIQGDQNDAEFLDRIARRYGPFDIVIDDGSHINAHVRTSFAALFPHVRPGGLY
VIEDMWTAYWPGFGGQADPQECSGTSLGLLKSLIDAIQHQELPSDPNRSPGYVDRNIVGL
HVYHNVAFVEKGRNDEGGIPTWIPRDFESLVQASSGGAT
Reference
  Authors
Anzai Y, Saito N, Tanaka M, Kinoshita K, Koyama Y, Kato F
  Title
Organization of the biosynthetic gene cluster for the polyketide macrolide mycinamicin in Micromonospora griseorubida.
  Journal
FEMS Microbiol Lett 218:135-41 (2003)
DOI:10.1111/j.1574-6968.2003.tb11509.x
Reference
  Authors
Li S, Anzai Y, Kinoshita K, Kato F, Sherman DH
  Title
Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics.
  Journal
Chembiochem 10:1297-301 (2009)
DOI:10.1002/cbic.200900088

DBGET integrated database retrieval system