KEGG   Addendum: BAC57029
Entry
BAC57029          CDS       T10000                                 
Symbol
mycAII
Name
(KEGG) protomycinolide IV synthase 2
  KO
K24559  protomycinolide IV synthase 2
Taxonomy
TAX:28040
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora griseorubida)
Module
28040_M00934  Mycinamicin biosynthesis, malonyl-CoA + methylmalonyl-CoA => protomycinolide IV => mycinamicin II
SSDB
Motif
Pfam: ketoacyl-synt KR Acyl_transf_1 Ketoacyl-synt_C PS-DH PP-binding adh_short KAsynt_C_assoc Thiolase_N Epimerase adh_short_C2 Docking Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind Lipase_GDSL_2 3Beta_HSD
Other DBs
NCBI-ProteinID: BAC57029
GB: AB089954
UniProt: Q83WE9
LinkDB
AA seq 1843 aa
MTATANRMREYLQRMTVELHGARQRLRHLEQQAREPIAIVGMSCRLPGGVSTPEQLWHLV
DSGTDAISPFPTDRGWDLAALYDPDPNRRGTVYSREAGFLHDCAGFDPEFFGLSPREALA
MDPQQRLLLETSWEAIEEAGIEPTSVRGSRTGVYLGVMYHDYGERLREIPEGMEGYLVNG
SAGSIASGRVAYTLGLEGPAVTVDTACSSSLVATHLAVQALRRQECDLALAGGATVLATP
RMLIDFARLRGLAPDGRCKAFAEAADGTSFADGVGVVLLERLSDAVERGHRVLAVIRGTA
VNQDGTTNGLTAPSGRAQQRVIQRALADADLGPDQIDAVEAHGTGTRLGDPIEAQALLAT
YGTSHPADRPLRLGSLKSNIGHTQAAAGVAGLMKMVLAMRHGRLPRTLHVDQPSSRVDWS
AGHVSLLTDPVTWPRLPGTPRRAAVSSFGASGTNAHLVLEEEPETPVAVETRPAPETAWT
VSGRSDAALRPGARLHEQVSVRGSVPVTARARALARARSPFAHRAVVLGRSEDELLDGLA
ALADGGGLPDRLVDRPDVDLAVERTADGKRKVCLLFTGQGSQYAGAGRQLHDSYPDFAEA
LDDVVAAFEPHLEQSLRDVMFAAPGTTRAMLLDRTEYTQPALFALGVALARPPRPLGGLR
PHALLGHSGGELAAHVAGVFTLDDAAALVAARGRLMRQLPEGGAMVAIGASEEEIVATLA
GRETRLALAAVNGPTATVVSGDEEAVLELAGIWRDRGRRTKRLNVRHAFHSPHLDAILAP
FEAAAREVGYRSPTVAVVSNVTGAYAGDELATPDYWVRHVRQPVRFHDGLRSVADAGVDL
FLELGPGGPLSAMAREALPDAVALPLLRRDRDEVSTTCRAVATAYVHGAGVELAALHGDG
PVIADGLPTYPFQRTRFWLAEPPPAPVQPAEVGMDPAAHPLLAAATDLPDAEGTVSTGLL
RVRDHPWLADHTVAGRIVLPGTALLDLASAGRARIVELTHQAPLVLPPEGAVKVRVRLGA
ADHAGLRTVRIDSCPTTGTSGWTRHATAVVAEPSPDPSGEPVGGDLGGAWPPVGAVPVDM
TGAYEELAAGIGYGPAFHGLHGVWRRADELFAEVTLPDGLSAVGWHVAHPALLDAMLHPI
AVSEHVTEAAGRLPFSWAEVRLTGGGTSTLRVRIAPAGPDSVTVTAADPDGRVVLSADQL
TLRRVDPAQLASDRTDPSLHRVEWTPATTDGAAETRWSVVGGAPALRDAAPGGAYPDLFA
DGDDAPCVVVEIVGEGSLPQAAHQVGHRALTLVQRWLVEETGDRRLVVLTHGAVDTGHGL
TDPAAAVAWGLVRAAQTEHPGRFVLVDLDDDDRSRRALSRILADDIGQVAIRSGVAHVPR
LVPVTVAAADEPWDPDGTVLITGGTGALGRAVARHVVQRHGVRHLLLAGRQGREAPGVAE
LVETLTADGTTVEVASCDVTDRAAVERLLTAVPADRPVVAVVHAAGVLADAVVSAQDGDR
LDAVLAPKVDAAVHLHDLTRDLPLARFVLFSSAAGVLGSAGQAAYASANAFLDALASWRR
SRGLPAVSLAWGPWESGMAATLDQRSVARLRIAESCPCARRRRSTSSTWPCALAGRTPSC
YPCDSTRPTVGPLRRARPGPCPTRSGAGTPPASPPGGGSGRPRFGLVERLAHAPRSERLS
TLQKLVRAETAGVLGHPDAGEQLDQNFHALGFDSLTAIEFRNRLNQATGVRLPATLIFDY
PTLAALAEHLESELPRAPEPGVTDVAGVLDVLDAVRRNLATSLTDGESRARVAESLRTLL
ADLAEPAAVPGDETRDAGSVRDRLRSASDDELFQLLDSDFRTH
Reference
  Authors
Anzai Y, Saito N, Tanaka M, Kinoshita K, Koyama Y, Kato F
  Title
Organization of the biosynthetic gene cluster for the polyketide macrolide mycinamicin in Micromonospora griseorubida.
  Journal
FEMS Microbiol Lett 218:135-41 (2003)
DOI:10.1111/j.1574-6968.2003.tb11509.x

DBGET integrated database retrieval system