KEGG   Addendum: BAD98249
Entry
BAD98249          CDS       T10000                                 
Symbol
CYP719A3
Name
(KEGG) stylopine synthase (EC:1.14.19.73)
  KO
K13395  (S)-stylopine/(S)-canadine/(S)-nandinine synthase [EC:1.14.19.64 1.14.19.68 1.14.19.73]
Taxonomy
TAX:3467
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Eschscholzioideae; Eschscholzia
Organism
ag  Addendum (Eschscholzia californica)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAD98249
GB: AB126256
UniProt: Q50LH4
LinkDB
AA seq 495 aa
MEEMKFLIMNNPWVLFATSATLLISIFLFFRRKSPNMAWPEGPKTLPIIGNMHLLGGTAL
QVVLYNLAKVHGRVMTIWIGSWRPVIVVSDIEQAWEVLVNKSSDYSARDMPDITKIVTAD
WRTISTSDSGPHWSNLRKGLQNIAISPNNLAAQFQFQEKDIIKMIQILEQEAKDNNGIVK
PLDHLKKATIRLISRLVFGRDFEEDKYVEDMHHAIEELIRISGYARLAEAFYYAKYLPSH
RKAVRYVEELKQIVKNLIRPFLSVNPPTNTYLHFLRSQNYDEEVVIFAIFETYLLGVDST
SSTTAWALAYLVREPSVQDRLHQELDHFAKQNDRKILKVEDMNKLQYLQAVIKETMRMKP
IAPLAIPHKACKDTSLMGNKINKGTRVMVNLYALHHNKNVFNDPFKFMPERFLKVDNQDA
KGKAMEQSLLPFSAGMRICAGMELGKLQFSFALANLIFAFKWSCVDDGVLPDMSDELGFV
LLMKTPLKARINPRN
Reference
  Authors
Ikezawa N, Iwasa K, Sato F
  Title
Molecular cloning and characterization of methylenedioxy bridge-forming enzymes involved in stylopine biosynthesis in Eschscholzia californica.
  Journal
FEBS J 274:1019-35 (2007)
DOI:10.1111/j.1742-4658.2007.05652.x

DBGET integrated database retrieval system