KEGG   Addendum: BAI44339
Entry
BAI44339          CDS       T10000                                 
Symbol
cotB3
Name
(KEGG) cyclooctat-9-en-7-ol 5-monooxygenase (EC:1.14.99.61)
  KO
K22997  cyclooctat-9-en-7-ol 5-monooxygenase [EC:1.14.99.61]
Taxonomy
TAX:67327
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces violaceusniger group
Organism
ag  Addendum (Streptomyces melanosporofaciens)
Module
67327_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAI44339
GB: AB448947
UniProt: C9K1X6
LinkDB
AA seq 459 aa
MRERGPVTPAKSSAPPERPWTTGTAPGSVPLLGHTMALWRRPLQFLASLPAHGDLVEVRL
GPSRAYLACHPELVRQVLLNPRVFDKGGVFDKARQLLGNSLSVSRGEDHRYQRRMIQPAF
HTPKIAAYTAAVADDTRAAIGSWEPGRTLDISDTMHALLMRVAARTLFSTGIDEATIDEA
RHCLRIVSDGIYKRTMAPLGIMEKLPTPGNRRYDRANARLRQIVDEMIRERRRSGADHGD
LLSTLLRAEHPETGKGLDDGEVLDQVVTFLVAGSETTASTLAFVFHLLGAHPEVEKRVHA
EIDEILEGRSPTFEDLPSLEYTRGVITESLRLYPPSWMAMRVTAAETELGGRTVPAGTMI
LYSAQALHHNPELFPDPERFDPERWLGDRAKEVERGALLPFGAGSHKCIGDVLALTETAL
IVATIASRWRLRPVPGTTLRPEPKATLEPGPLPMVCEPR
Reference
  Authors
Kim SY, Zhao P, Igarashi M, Sawa R, Tomita T, Nishiyama M, Kuzuyama T
  Title
Cloning and heterologous expression of the cyclooctatin biosynthetic gene cluster afford a diterpene cyclase and two p450 hydroxylases.
  Journal
Chem Biol 16:736-43 (2009)
DOI:10.1016/j.chembiol.2009.06.007

DBGET integrated database retrieval system