KEGG   Addendum: BAI70377
Entry
BAI70377          CDS       T10000                                 
Symbol
dcsC
Name
(KEGG) O-ureido-serine racemase (EC:5.1.1.19)
  KO
K19724  O-ureido-serine racemase [EC:5.1.1.19]
Taxonomy
TAX:1914
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces lavendulae)
Module
1914_M00785  Cycloserine biosynthesis, arginine/serine => cycloserine
SSDB
Motif
Pfam: DAP_epimerase
Other DBs
NCBI-ProteinID: BAI70377
GB: AB516431
UniProt: D2Z026
Structure
LinkDB
AA seq 287 aa
MIRMRTPSTLPFTKMHGAGNDFVVLDLRDGPDPSPELCRALADRHKGVGCDLVLGIREPR
SARAVAAFDIWTADGSRSAQCGNGARCVAAWAVRAGLARGPRFALDSPSGTHEVDVLDAD
TFRVALAVPRFAPESIPLFGHDGEQDLYEADLGDGTRVRFAAVSMGNPHAVIEVDDTATA
PVARVGRAVQASGLFLPTVNVGFARVESRDRVHLRVHEYGAGETLACGSGACAAAAVLMR
RGRVDRNVSVVLPGGELRISWPDDAADVLMTGPAAFVYEGTFLHASV
Reference
  Authors
Kumagai T, Koyama Y, Oda K, Noda M, Matoba Y, Sugiyama M
  Title
Molecular cloning and heterologous expression of a biosynthetic gene cluster for the antitubercular agent D-cycloserine produced by Streptomyces lavendulae.
  Journal
Antimicrob Agents Chemother 54:1132-9 (2010)
DOI:10.1128/AAC.01226-09
Reference
  Authors
Dietrich D, van Belkum MJ, Vederas JC
  Title
Characterization of DcsC, a PLP-independent racemase involved in the biosynthesis of D-cycloserine.
  Journal
Org Biomol Chem 10:2248-54 (2012)
DOI:10.1039/c2ob06864h

DBGET integrated database retrieval system