KEGG   Addendum: BAM76237
Entry
BAM76237          CDS       T10000                                 

Gene name
bphAb
Definition
(KEGG) biphenyl/DDE 2,3-dioxygenase small subunit
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Taxonomy
TAX:946335
  Lineage
Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae; Janibacter; unclassified Janibacter
Organism
ag  Addendum (Janibacter sp. TYM3221)
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: BAM76237
GB: AB733643
UniProt: F8WQD4
LinkDB
AA seq 188 aa
MTIDIESLPVAFSAKPRPVEPALQHEIEQFYYWEAKLLNDRRFPEWFALLAEDIHYFMPI
RSTRIMREAHLEWSGPADYAHFDDNADMMRGRLRKITSDVSWSENPASRTRHSISNVMIR
DGDRSDEYDISNVFIVYRSRLERQVDIFAGERRDILRRTDTEAGFEIVKRTILLDQSTVL
SNNLSFFF
Reference
  Authors
Nguyen PA, Trinh TH, Fukumitsu Y, Shimodaira J, Miyauchi K, Tokuda M, Kasai D, Masai E, Fukuda M
  Title
Gene cluster and regulation system for 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene (DDE) degradation in Janibacter sp.  TYM3221.
  Journal
J Biosci Bioeng 116:91-100 (2013)
DOI:10.1016/j.jbiosc.2013.01.007

DBGET integrated database retrieval system