KEGG   Addendum: BAM76241
Entry
BAM76241          CDS       T10000                                 

Gene name
bphC
Definition
(KEGG) 2,3-dihydroxybiphenyl/2,3-dihydroxy-DDE 1,2-dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Taxonomy
TAX:946335
  Lineage
Bacteria; Actinobacteria; Micrococcales; Intrasporangiaceae; Janibacter; unclassified Janibacter
Organism
ag  Addendum (Janibacter sp. TYM3221)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3
Other DBs
NCBI-ProteinID: BAM76241
GB: AB733643
UniProt: L8B2S2
LinkDB
AA seq 295 aa
MSVQRLGYLGMEVSDVDAWRTFATSRLGAMESPAEGAGARFRLDSRSWRFEVTPGPSDDL
ALAGYEVDSEEALAAVKQRLEDFGVKVTTESRELAAERGVLGLISCNDPTDTRIEIYYGG
TEVFEVPFASPTGVTGFRTGDQGMGHYVMAVPDVEAALDFYIQGLGFHLSDIIDWQLNPE
MSARLYFLHCNGRHHTLALAALPGSKKLHHFMLETTSMDDVGLAYDRCVDDDAVVMTLGR
HTNDHMVSFYGGTPSGFAVEFGWGARLVEPGWSVVRYDSISIWGHKFVGAPQAPA
Reference
  Authors
Nguyen PA, Trinh TH, Fukumitsu Y, Shimodaira J, Miyauchi K, Tokuda M, Kasai D, Masai E, Fukuda M
  Title
Gene cluster and regulation system for 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene (DDE) degradation in Janibacter sp.  TYM3221.
  Journal
J Biosci Bioeng 116:91-100 (2013)
DOI:10.1016/j.jbiosc.2013.01.007

DBGET integrated database retrieval system