KEGG   Addendum: CAA55681
Entry
CAA55681          CDS       T10000                                 
Symbol
cbdA
Name
(KEGG) 2-halobenzoate 1,2-dioxygenase large subunit (EC:1.14.12.13)
  KO
K08686  2-halobenzoate 1,2-dioxygenase large subunit [EC:1.14.12.13]
Taxonomy
TAX:292
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia; Burkholderia cepacia complex
Organism
ag  Addendum (Burkholderia cepacia)
SSDB
Motif
Pfam: Rieske Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: CAA55681
GB: X79076
UniProt: Q51601
LinkDB
AA seq 465 aa
MSTPLIAGTGPSAVRQLISNAVQNDPVSGNFRCRRDIFTDAALFDYEMKYIFEQNWVFLA
HESQVANPDDYLVSNIGRQPVIITRNKAGDVSAVINACSHRGAELCRRKQGNRSTFTCQF
HGWTFSNTGKLLKVKDGQDDNYPEGFNVDGSHDLTRIPSFANYRGFLFGSMNPDACPIEE
HLGGSKAILDQVIDQTPGELEVLRGSSSYIYDGNWKLQIENGADGYHVGSVHWNYVATIG
RRDRTSDTIRTVDVTTWSKKNIGGTYTFEHGHMLLWTRLPNPEVRPVFARREELKARVGE
EVADAIVNQTRNLCIYPNLYVMDQISTQIRVVRPISVDKTEVTIYCFAPRDESEEVRNAR
IRQYEDFFNVSGMGTPDDLEEFRACQSGYRGSAREWNDLSRGAPHWISGPDDNARRLGLA
PLMSGARMEDEGLFVQQHTYWAETMLRGIEAEPKVFNVQPVEVAQ
Reference
PMID:7530709
  Authors
Haak B, Fetzner S, Lingens F
  Title
Cloning, nucleotide sequence, and expression of the plasmid-encoded genes for the two-component 2-halobenzoate 1,2-dioxygenase from Pseudomonas cepacia 2CBS.
  Journal
J Bacteriol 177:667-75 (1995)
DOI:10.1128/JB.177.3.667-675.1995

DBGET integrated database retrieval system