| Entry |
|
| Symbol |
SHV-6
|
| Name |
(KEGG) beta-lactamase class A SHV-6
|
| KO |
|
| Taxonomy |
|
| Lineage |
Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella/Raoultella group; Klebsiella; Klebsiella pneumoniae complex |
| Organism |
Klebsiella pneumoniae
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| AA seq |
286 aa
MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADE
RFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCA
AAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARATTTPA
SMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARG
IVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR |
| Comment |
Added 10 N-terminal residues and 16 C-terminal residues.
|
| Reference |
|
| Authors |
Arlet G, Rouveau M, Philippon A |
| Title |
Substitution of alanine for aspartate at position 179 in the SHV-6 extended-spectrum beta-lactamase. |
| Journal |
|