KEGG   Addendum: CAA75722
Entry
CAA75722          CDS       T10000                                 
Symbol
VAOA
Name
(KEGG) vanillyl-alcohol oxidase (EC:1.1.3.38)
  KO
K20153  vanillyl-alcohol oxidase [EC:1.1.3.38]
Taxonomy
TAX:69488
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium
Organism
ag  Addendum (Penicillium simplicissimum)
SSDB
Motif
Pfam: FAD_binding_4 FAD-oxidase_C SKICH
Other DBs
NCBI-ProteinID: CAA75722
GB: Y15627
UniProt: P56216
Structure
LinkDB
AA seq 560 aa
MSKTQEFRPLTLPPKLSLSDFNEFIQDIIRIVGSENVEVISSKDQIVDGSYMKPTHTHDP
HHVMDQDYFLASAIVAPRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSGSVV
LDMGKNMNRVLEVNVEGAYCVVEPGVTYHDLHNYLEANNLRDKLWLDVPDLGGGSVLGNA
VERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRPETMGLKPEDQPWSKIAH
LFPYGFGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLR
LGMALQNVPTIRHILLDAAVLGDKRSYSSKTEPLSDEELDKIAKQLNLGRWNFYGALYGP
EPIRRVLWETIKDAFSAIPGVKFYFPEDTPENSVLRVRDKTMQGIPTYDELKWIDWLPNG
AHLFFSPIAKVSGEDAMMQYAVTKKRCQEAGLDFIGTFTVGMREMHHIVCIVFNKKDLIQ
KRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGI
IAPGKSGVWPSQYSHVTWKL
Reference
PMID:9525880
  Authors
Benen JA, Sanchez-Torres P, Wagemaker MJ, Fraaije MW, van Berkel WJ, Visser J
  Title
Molecular cloning, sequencing, and heterologous expression of the vaoA gene from Penicillium simplicissimum CBS 170.90 encoding vanillyl-alcohol oxidase.
  Journal
J Biol Chem 273:7865-72 (1998)
DOI:10.1074/jbc.273.14.7865
Reference
PMID:1396672
  Authors
de Jong E, van Berkel WJ, van der Zwan RP, de Bont JA
  Title
Purification and characterization of vanillyl-alcohol oxidase from Penicillium simplicissimum. A novel aromatic alcohol oxidase containing covalently bound FAD.
  Journal
Eur J Biochem 208:651-7 (1992)
DOI:10.1111/j.1432-1033.1992.tb17231.x

DBGET integrated database retrieval system