KEGG   Addendum: CAA80668
Entry
CAA80668          CDS       T10000                                 
Name
(KEGG) trypanothione-disulfide reductase (EC:1.8.1.12)
  KO
K04283  trypanothione-disulfide reductase [EC:1.8.1.12]
Taxonomy
TAX:5661
  Lineage
Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina; Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania
Organism
Leishmania donovani
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like FAD_binding_2 Thi4 GIDA Amino_oxidase
Other DBs
NCBI-ProteinID: CAA80668
GB: Z23135
UniProt: P39050
LinkDB
AA seq 491 aa
MSRAYDLVVLGAGSGGLEAGWNAAVTHKKKVAVVDVQATHGPPALVALGGTCVNVGCVPK
KLMVTGAQYMDLIRESGGFGWEMDRESLCPNWKTLIAAKNKVVNSINESYKSMFADTEGL
SFHMGFGALQDAHTVVVRKSEDPHSDVLETLDTEYILIATGSWPTRLGVPGDEFCITSNE
AFYLEDAPKRMLCVGGGYIAVEFAGIFNGYKPCGGYVDLCYRGDLILRGFDTEVRKSLTK
QLGANGIRVRTNLNPTKITKNEDGSNHVHFNDGTEEDYDQVMLAIGVPRSQALQLDKAGV
RTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGACVLLETVFGGKPRATDHT
KVACAVFSIPPIGTCGMTEEEAAKNYETVAVYASSFTPLMHNISGSKHKEFMIRIITNES
NGEVLGVHMLGDSAPEIIQSVGICMKMGAKISDFHSTIGVHPTSAEELCSMRTPAYFYES
GKRVEKLSSNL
Reference
PMID:7935607
  Authors
Taylor MC, Kelly JM, Chapman CJ, Fairlamb AH, Miles MA
  Title
The structure, organization, and expression of the Leishmania donovani gene encoding trypanothione reductase.
  Journal
Mol Biochem Parasitol 64:293-301 (1994)
DOI:10.1016/0166-6851(94)00034-4
Reference
PMID:7607216
  Authors
Cunningham ML, Fairlamb AH
  Title
Trypanothione reductase from Leishmania donovani. Purification, characterisation and inhibition by trivalent antimonials.
  Journal
Eur J Biochem 230:460-8 (1995)
DOI:10.1111/j.1432-1033.1995.0460h.x

DBGET integrated database retrieval system