KEGG   Addendum: CAC80883
Entry
CAC80883          CDS       T10000                                 
Symbol
CYP76B6
Name
(KEGG) geraniol 8-hydroxylase (EC:1.14.14.83)
  KO
K15099  geraniol 8-hydroxylase [EC:1.14.14.83]
Taxonomy
TAX:4058
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Organism
Catharanthus roseus
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CAC80883
GB: AJ251269
UniProt: Q8VWZ7
LinkDB
AA seq 493 aa
MDYLTIILTLLFALTLYEAFSYLSRRTKNLPPGPSPLPFIGSLHLLGDQPHKSLAKLSKK
HGPIMSLKLGQITTIVISSSTMAKEVLQKQDLAFSSRSVPNALHAHNQFKFSVVWLPVAS
RWRSLRKVLNSNIFSGNRLDANQHLRTRKVQELIAYCRKNSQSGEAVDVGRAAFRTSLNL
LSNLIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLVDFFPLLEKVDPQGIRHRMTIHF
GEVLKLFGGLVNERLEQRRSKGEKNDVLDVLLTTSQESPEEIDRTHIERMCLDLFVAGTD
TTSSTLEWAMSEMLKNPDKMKKTQDELAQVIGRGKTIEESDINRLPYLRCVMKETLRIHP
PVPFLIPRKVEQSVEVCGYNVPKGSQVLVNAWAIGRDETVWDDALAFKPERFMESELDIR
GRDFELIPFGAGRRICPGLPLALRTVPLMLGSLLNSFNWKLEGGMAPKDLDMEEKFGITL
QKAHPLRAVPSTL
Reference
  Authors
Collu G, Unver N, Peltenburg-Looman AM, van der Heijden R, Verpoorte R, Memelink J
  Title
Geraniol 10-hydroxylase, a cytochrome P450 enzyme involved in terpenoid indole alkaloid biosynthesis.
  Journal
FEBS Lett 508:215-20 (2001)
DOI:10.1016/S0014-5793(01)03045-9
Reference
  Authors
Sung PH, Huang FC, Do YY, Huang PL
  Title
Functional expression of geraniol 10-hydroxylase reveals its dual function in the biosynthesis of terpenoid and phenylpropanoid.
  Journal
J Agric Food Chem 59:4637-43 (2011)
DOI:10.1021/jf200259n

DBGET integrated database retrieval system