KEGG   Addendum: CAD47935
Entry
CAD47935          CDS       T10000                                 
Symbol
nit
Name
(KEGG) 2-oxoglutaramate amidase (EC:3.5.1.111)
  KO
K08590  2-oxoglutaramate amidase [EC:3.5.1.111]
Taxonomy
TAX:29320
  Lineage
Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Paenarthrobacter
Organism
ag  Addendum (Paenarthrobacter nicotinovorans)
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: CAD47935
GB: AJ507836
UniProt: Q93NG1
LinkDB
AA seq 294 aa
MNLMEVRELAPSRGQLDVAAVQVKFDSTELLEDRISRIQDLVSGVGKADLIVLPELWLHG
GFSYDSWRKNAISLESEVFTFLSEVARDKKAWFHAGSFMVTEPSSAASDMWNTSVLFDPT
GSLRATYKKIHRFGFSDGEPKLIAAGDEPRVVELQTERATAITGLSTCYDLRFPELYRHI
SAEGTALNVIPACWPLTRIQHWQTLGRARAIENQSFVVQCNMTGVDQEVELGGHSQIVDG
NGDILAQADKEEAVLRATLNFDSLNELRSSFPVLNDRRADIWAAKGKTVIASHL
Reference
  Authors
Igloi GL, Brandsch R
  Title
Sequence of the 165-kilobase catabolic plasmid pAO1 from Arthrobacter nicotinovorans and identification of a pAO1-dependent nicotine uptake system.
  Journal
J Bacteriol 185:1976-86 (2003)
DOI:10.1128/JB.185.6.1976-1986.2003
Reference
  Authors
Cobzaru C, Ganas P, Mihasan M, Schleberger P, Brandsch R
  Title
Homologous gene clusters of nicotine catabolism, including a new omega-amidase for alpha-ketoglutaramate, in species of three genera of Gram-positive bacteria.
  Journal
Res Microbiol 162:285-91 (2011)
DOI:10.1016/j.resmic.2011.01.001

DBGET integrated database retrieval system