KEGG   Addendum: CAH55631
Entry
CAH55631          CDS       T10000                                 
Symbol
pigC
Name
(KEGG) prodigiosin synthetase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Taxonomy
TAX:616
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Yersiniaceae; Serratia
Organism
Serratia sp.
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: CAH55631
GB: AJ833001
UniProt: Q5W269
LinkDB
AA seq 890 aa
MNQPLVVEISGDKALEHHHLGGKGYSLNNLIHAGLPVPSAFCVTAQAYQQFIEEVVPGAE
LTDGDLIAVRDAILHADIPDSLKQAIGDAYQHLGHDTTIAVRSSALDEDGQRQSFAGQYE
TYLHVKGSEAVLHKVQACWASLWAERAAQYRHESASHSAIAVILQVMVDADAAGVMFTQD
PLSGSTDKVVIDSCWGLGEGVVSGQVTTDSFTLDKATGELCDQQIRHKPNYCQRDEHGLV
TLLQTPEAKRDLPSLTPAQLQQLVTLARQAQLIYSTELDIEWAVKDDKVWLLQARPVTTS
AKTANVIYANPWESDPAAKEGAFFSRMDTGEIVTGLMTPLGLSFCQFYQKHIHGPAIKTM
GLADISHWQIYMGYIQGYVYLNISGSAYMLRQCPPTRNEMKFTTRYATDEIDFKDYKNPY
GAGVQGWDYAKSCWYWLKQQVRNMRSAARTVEQMIALRQDETTRFLGLDLTAMTLQQLDQ
ELQRIDRFFLDSCAAYMPFFLQSFALYDALAQACERHIKDGKGLQNRIKASMNNLRTIEV
TLGIIKLVATVNQQTELKALFEQHRADELVTLLPVHDISRAFWQGDFEDFLVEFGSRGRQ
EFDLSIPRWRDDPSYLLQVMKMYLQHPVDLHKKLRETELLRQQDSEALFSAMSWSGRFKL
KTLIKLYGMMAERREATRPTFITETWFYRCIMLEVLRRLDAQGIASSADLPYVDFEQFRA
YVAGTIPAEQAFSKARLDQNRHQHLFNLHAEEPPMAIVGPYTPKVKAPTQDDKTIRSLTG
LAASPGNVVAKARVITDLQVQAGEFQPDEILVARFTDASWTPLFALAAGIVTDIGSTLSH
SCIVAREFGIPAVVNLKTATQIINSGDMLILDGDSGTVIIQHQEERNHDG
Reference
  Authors
Harris AK, Williamson NR, Slater H, Cox A, Abbasi S, Foulds I, Simonsen HT, Leeper FJ, Salmond GP
  Title
The Serratia gene cluster encoding biosynthesis of the red antibiotic, prodigiosin, shows species- and strain-dependent genome context variation.
  Journal
Microbiology 150:3547-60 (2004)
DOI:10.1099/mic.0.27222-0

DBGET integrated database retrieval system