KEGG   Addendum: CAH55633
Entry
CAH55633          CDS       T10000                                 
Symbol
pigE
Name
(KEGG) 3-acetyloctanal aminotransferase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Taxonomy
TAX:616
  Lineage
Bacteria; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Yersiniaceae; Serratia
Organism
Serratia sp.
SSDB
Motif
Pfam: Aminotran_3 DUF5587 AI-2E_transport
Other DBs
NCBI-ProteinID: CAH55633
GB: AJ833001
UniProt: Q5W267
LinkDB
AA seq 853 aa
MKFGFIAHPTSVGLKRYVKMIDLLQRNSTELHSGYKRDLWRRENLVPFMNFAKITSATGA
TCEGVIKYMPLVADEMLADARGIANRVVSGIEELVEDGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKALMQIQSWLDIQPEQEPVAIVGYPGSICLALSRLLLAQGFS
LHLLHRAGHKDEDELLSHLPEQYRSRVTLTSDPEDLYPRCKLFVAATSAGGVIDPYKLQP
GSVFIDVALPRDINSDTRPDRDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALENRRENFSLGRYLALDNVLEIGELAEKHGFLVYPLASYGERIDRQRVINLKRYYH
HDIYSDEPDTEQPPASQLAFIDAIIAQDPAREDTLDRYHQFINPMMVEFLKLQHCDNVFR
RASGTQLFTADGEAFLDMVAGYGCINLGHNPQPIIDALKAYLDAQGPNFIQYISIPEQAA
KLAEVLCHFAPGNMGRVFFSNSGTEAVEAAMKLAKASTGKAGIAYLKNSYHGKTLGALSI
TGREKHRRHFKPLLASMIEVPFADIEALRQTLSRDDIGALMIEPIQGEGGVHVPPPGYLR
TVQEICRQTDTLLMVDEVQTGLGRTGKLFACEWEGIEPDVLMLSKSLSGGVMPIGATLCR
AIFGNGPYGTADRFLMHSSTFGGGNIAAVVALSALREILAQDLVGNAERLGTYFKQALTD
VAARYPFVAEIAGRGLMLGIQFDQTFAGAVGASAREFATRLPGDWHTTWKFLPDPVQAHL
KAAMERMEQSLGEMFCMKFVTKLCQDHNILTFITANSSTVIRIQPPLTISKAEIDRFVSA
FATVCDELSTFLE
Reference
  Authors
Harris AK, Williamson NR, Slater H, Cox A, Abbasi S, Foulds I, Simonsen HT, Leeper FJ, Salmond GP
  Title
The Serratia gene cluster encoding biosynthesis of the red antibiotic, prodigiosin, shows species- and strain-dependent genome context variation.
  Journal
Microbiology 150:3547-60 (2004)
DOI:10.1099/mic.0.27222-0

DBGET integrated database retrieval system