KEGG   Addendum: CAL48953
Entry
CAL48953          CDS       T10000                                 
Symbol
auaA
Name
(KEGG) 2-methyl-4-hydroxyquinoline prenyltransferase
  KO
K22799  2-methyl-4-hydroxyquinoline prenyltransferase [EC:2.5.1.-]
Taxonomy
TAX:41
  Lineage
Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales; Cystobacterineae; Archangiaceae; Stigmatella
Organism
ag  Addendum (Stigmatella aurantiaca)
Module
41_M00848  Aurachin biosynthesis, anthranilate => aurachin A
SSDB
Motif
Pfam: UbiA DUF3040 MatC_N
Other DBs
NCBI-ProteinID: CAL48953
GB: AM404078
UniProt: A4F5C0
LinkDB
AA seq 326 aa
MTLLQVGSIRFTAFYLAAFSTAIAATGHDPVPWLALSVPLWMVKCLAIELTNRYADRIED
AVNRQERTLLCEQVGYDTIRRAAIGLNALVLAFYLAWFVEWRRPELFAVQLVSWLVMWNY
SVGLRFKGRRLGVLVALCGTFILPFLCGWMIYGQFKDVPLPILSMLVFVFSLSGIKDITD
VEGDAKRGYRSFFVDVASRRSAARLLLLLGSPYLFIAGLVAFGAAPPRFLALVAFAPVSL
LFASLVRGAREPHERTTIREWTYHFWFVFLMGILLLVHPTVQNAAVLGGCVAFWVVATRR
LHWAVGLRADQVEDVSRILSRVFVAS
Comment
Unpublished sequence data: Sandmann A (2011).
Reference
  Authors
Stec E, Pistorius D, Muller R, Li SM
  Title
AuaA, a membrane-bound farnesyltransferase from Stigmatella aurantiaca, catalyzes the prenylation of 2-methyl-4-hydroxyquinoline in the biosynthesis of aurachins.
  Journal
Chembiochem 12:1724-30 (2011)
DOI:10.1002/cbic.201100188

DBGET integrated database retrieval system