| Entry |
|
|---|
| Symbol |
auaB
|
|---|
| Name |
(KEGG) acyl carrier protein AuaB
|
|---|
| KO |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Pseudomonadati; Myxococcota; Myxococcia; Myxococcales; Cystobacterineae; Archangiaceae; Stigmatella |
|---|
| Organism |
Stigmatella aurantiaca
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
84 aa
MTRDEIRSKVMQIAAEIFELEPEALLGDKHIVDELGATSVLRLEFIVMLERGFKFQFNPE
EIEVAQNLNEVVDVVEKLLRGKGS |
|---|
| Comment |
Unpublished sequence data: Sandmann A (2011).
|
|---|
| Reference |
|
|---|
| Authors |
Pistorius D, Li Y, Sandmann A, Muller R |
|---|
| Title |
Completing the puzzle of aurachin biosynthesis in Stigmatella aurantiaca Sg a15. |
|---|
| Journal |
|
|---|
| Reference |
|
|---|
| Authors |
Sandmann A, Dickschat J, Jenke-Kodama H, Kunze B, Dittmann E, Muller R |
|---|
| Title |
A Type II polyketide synthase from the gram-negative Bacterium Stigmatella aurantiaca is involved in Aurachin alkaloid biosynthesis. |
|---|
| Journal |
|
|---|
