KEGG   Addendum: CAL48957
Entry
CAL48957          CDS       T10000                                 
Symbol
auaE
Name
(KEGG) anthranilate-CoA-ACP transferase
  KO
K22798  anthranilate-CoA-ACP transferase [EC:6.2.1.-]
Taxonomy
TAX:41
  Lineage
Bacteria; Pseudomonadota; Deltaproteobacteria; Myxococcales; Cystobacterineae; Archangiaceae; Stigmatella
Organism
Stigmatella aurantiaca
Module
41_M00848  Aurachin biosynthesis, anthranilate => aurachin A
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: CAL48957
GB: AM404078
UniProt: A4F5C4
LinkDB
AA seq 497 aa
MSGANVFATLVTRHLEAGKGERPAYRQTGRTYTYAELERLSARAAGLLHEAGLRRGDRVL
CLAGDSVEIIALVLGAFRLGAVAVVANQLSPAAKLRFLCEDTAAQVVIVSSVSASALASW
TERPASLRSIWFQGEGEAGSFPRLEESIAAMPPRESVEPVEGTHPACWQYTHGADGTELA
VVHSHQGLAAAVEPFARAKLGLCESDVVFSIAKLYFGYGFANSLVFPLAAGACTLLHPGR
SDVLTVMELVRREHPTVFFGVPTFYSGILKVPSAAQRFDVSSVRAFVSAGEELSASLARK
FKDTFGSLPVNGLGSTEMFHIYIATELRGDSPGSLGTLTPGHEVRLLSASGQPVADGEVG
ELWVRGPHIGVGYAHHPEHTRRVFVEGWVRTGDLVTRDASGAYVFRGRTDALLKVAGQKT
LLFEVEQCLRSHEAVVEAEVQVVVDEDGIRDLLAKVRLREGVAPGNATVRVLRTFMRERL
LPHSCPSKIEVLSGSAS
Comment
Unpublished sequence data: Sandmann A (2011).
Reference
  Authors
Pistorius D, Li Y, Sandmann A, Muller R
  Title
Completing the puzzle of aurachin biosynthesis in Stigmatella aurantiaca Sg a15.
  Journal
Mol Biosyst 7:3308-15 (2011)
DOI:10.1039/c1mb05328k
Reference
  Authors
Sandmann A, Dickschat J, Jenke-Kodama H, Kunze B, Dittmann E, Muller R
  Title
A Type II polyketide synthase from the gram-negative Bacterium Stigmatella aurantiaca is involved in Aurachin alkaloid biosynthesis.
  Journal
Angew Chem Int Ed Engl 46:2712-6 (2007)
DOI:10.1002/anie.200603513

DBGET integrated database retrieval system